Web Results

en.wikipedia.org/wiki/Alefacept

Alefacept is a genetically engineered immunosuppressive drug. It was sold under the brand name Amevive in Canada, the United States, Israel, Switzerland and ...

www.rxlist.com/amevive-drug.htm

AMEVIVE® (alefacept) is a CD2-directed LFA-3/Fc fusion protein that consists of the extracellular CD2-binding portion of the human leukocyte function antigen-3 ...

www.psoriasis.org/media/press-releases/amevive-alefacept-voluntarily-discontinued-us

Nov 16, 2011 ... Astellas Pharma U.S. Inc. (Astellas) has voluntarily discontinued the promotion, manufacturing, distribution and sales of Amevive (alefacept), ...

www.medicinenet.com/alefacept/article.htm

Alefacept (Amevive) medication for adults with moderate to severe placuqe psoriasis. Side effects, dosage, pregnancy safety information, and drug interactions.

www.accessdata.fda.gov/drugsatfda_docs/label/2012/125036s0144lbl.pdf

reconstituted solution contains 15 mg of alefacept. Rotate injection sites so that a different site is used for each new injection. New injections should be given at ...

www.astellas.us/docs/amevive.pdf

AMEVIVE® (alefacept) is an immunosuppressive dimeric fusion protein that consists ... AMEVIVE® for intramuscular injection contains 15 mg alefacept, 12.5 mg ...

www.ncbi.nlm.nih.gov/pmc/articles/PMC2386357

Alefacept is the first biological agent approved by the US Food and Drug Administration (FDA) for the treatment of moderate to severe chronic plaque psoriasis.

livertox.nih.gov/Alefacept.htm

Alefacept is a recombinant fusion protein of lymphocyte function associated antigen-3 (LFA-3) and immunoglobulin G dimer that acts to inactive T cells, and is an ...

www.drugbank.ca/drugs/DB00092

Jun 13, 2005 ... >Alefacept light chain MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK  ...